AGO1 Rabbit Polyclonal Antibody

CAT#: TA334444

Rabbit Polyclonal Anti-AGO1 Antibody

Product Images

WB Suggested Anti-AGO1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

• 

  Host: Rabbit; Target Name: EIF2C1; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; AGO1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AGO1 antibody: synthetic peptide directed towards the N terminal of human AGO1. Synthetic peptide located within the following region: MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: argonaute 1, RISC catalytic component
• Database Link:
  NP_036331
  Entrez Gene 26523 Human
  UniProt ID Q9UL18
• Background: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and argonaute 4. [provided by RefSeq, Jul 2008]
• Synonyms: EIF2C; EIF2C1; GERP95; Q99
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome