Pallidin (BLOC1S6) Rabbit Polyclonal Antibody

CAT#: TA334453

Rabbit Polyclonal Anti-BLOC1S6 Antibody

Product Images

WB Suggested Anti-BLOC1S6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BLOC1S6 antibody: synthetic peptide directed towards the middle region of human BLOC1S6. Synthetic peptide located within the following region: EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: biogenesis of lysosomal organelles complex 1 subunit 6
• Database Link:
  NP_036520
  Entrez Gene 26258 Human
  UniProt ID Q9UL45
• Background: BLOC1S6 may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: BLOS6; HPS9; PA; PALLID; PLDN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%