Thioredoxin 2 (TXN2) Rabbit Polyclonal Antibody

CAT#: TA334463

Rabbit Polyclonal Anti-TXN2 Antibody

Product Images

WB Suggested Anti-TXN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TXN2 antibody: synthetic peptide directed towards the middle region of human TXN2. Synthetic peptide located within the following region: VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: thioredoxin 2
• Database Link:
  NP_036605
  Entrez Gene 25828 Human
  UniProt ID Q99757
• Background: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: COXPD29; MT-TRX; MTRX; TRX2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome