PSCD4 (CYTH4) Rabbit Polyclonal Antibody

CAT#: TA334483

Rabbit Polyclonal Anti-CYTH4 Antibody

Product Images

WB Suggested Anti-PSCD4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CYTH4 antibody: synthetic peptide directed towards the N terminal of human CYTH4. Synthetic peptide located within the following region: NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: cytohesin 4
• Database Link:
  NP_037517
  Entrez Gene 27128 Human
  UniProt ID Q9UIA0
• Background: CYTH4 promotes guanine-nucleotide exchange on ARF1 and ARF5. CYTH4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (CYTH4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The CYTH4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The CYTH4 and PSCD1 gene structures are very similar.
• Synonyms: CYT4; DJ63G5.1; PSCD4
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 91%; Guinea pig: 86%