Methyltransferase like 5 (METTL5) Rabbit Polyclonal Antibody

CAT#: TA334497

Rabbit Polyclonal Anti-METTL5 Antibody

Product Images

WB Suggested Anti-METTL5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HT1080 cell lysateMETTL5 is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-METTL5 antibody: synthetic peptide directed towards the N terminal of human METTL5. Synthetic peptide located within the following region: IAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: methyltransferase like 5
• Database Link:
  NP_054887
  Entrez Gene 29081 Human
  UniProt ID Q9NRN9
• Background: METTL5 is a probable methyltransferase.
• Synonyms: HSPC133
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome