MEMO1 Rabbit Polyclonal Antibody

CAT#: TA334504

Rabbit Polyclonal Anti-NCDN Antibody

Product Images

WB Suggested Anti-NCDN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NCDN antibody: synthetic peptide directed towards the N terminal of human NCDN. Synthetic peptide located within the following region: MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: mediator of cell motility 1
• Database Link:
  NP_057039
  Entrez Gene 51072 Human
  UniProt ID Q9Y316
• Background: This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes. Several alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Jul 2008]
• Synonyms: C2orf4; CGI-27; MEMO; NS5ATP7
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%