Glutaminase (GLS) Rabbit Polyclonal Antibody

CAT#: TA334558

Rabbit Polyclonal Anti-GLS Antibody

Product Images

GLS antibody - C-terminal region validated by WB using Cortex/Kidney/Brain at 1: 2000.

• 

  WB Suggested Anti-GLS Antibody Titration: 0.2-1 ug/ml; Positive Control: ACHN cell lysateGLS is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: glutaminase
• Database Link:
  NP_055720
  Entrez Gene 24398 RatEntrez Gene 2744 Human
  UniProt ID O94925
• Background: Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances
• Synonyms: AAD20; GAC; GAM; GLS1; KGA
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Dog: 86%; Mouse: 86%

Reference Data

• Protein Pathways: Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, D-Glutamine and D-glutamate metabolism, Metabolic pathways, Nitrogen metabolism