SLC46A3 Rabbit Polyclonal Antibody

CAT#: TA334625

Rabbit Polyclonal Anti-SLC46A3 Antibody

Product Images

WB Suggested Anti-SLC46A3 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate;SLC46A3 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC46A3 antibody: synthetic peptide directed towards the N terminal of human SLC46A3. Synthetic peptide located within the following region: MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: solute carrier family 46 member 3
• Database Link:
  NP_861450
  Entrez Gene 283537 Human
  UniProt ID Q7Z3Q1
• Background: The function remains unknown.
• Synonyms: FKSG16
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 85%; Dog: 79%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane