ATP7A Rabbit Polyclonal Antibody

CAT#: TA334643

Rabbit Polyclonal Anti-ATP7A Antibody

Product Images

Host: Rabbit; Target Name: ATP7A; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATP7A antibody is: synthetic peptide directed towards the middle region of Human ATP7A. Synthetic peptide located within the following region: MGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: ATPase copper transporting alpha
• Database Link:
  NP_000043
  Entrez Gene 538 Human
  UniProt ID Q04656
• Background: The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.
• Synonyms: DSMAX; MK; MNK; SMAX3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Yeast: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane