Butyrylcholinesterase (BCHE) Rabbit Polyclonal Antibody

CAT#: TA334644

Rabbit Polyclonal Anti-BCHE Antibody

Product Images

WB Suggested Anti-BCHE Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BCHE antibody: synthetic peptide directed towards the N terminal of human BCHE. Synthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: butyrylcholinesterase
• Database Link:
  NP_000046
  Entrez Gene 590 Human
  UniProt ID P06276
• Background: Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.
• Synonyms: CHE1; CHE2; E1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane