Chymotrypsin like protease (CTRL) Rabbit Polyclonal Antibody

CAT#: TA334671

Rabbit Polyclonal Anti-CTRL Antibody

Product Images

WB Suggested Anti-CTRL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: CTRL; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CTRL; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CTRL; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTRL antibody: synthetic peptide directed towards the N terminal of human CTRL. Synthetic peptide located within the following region: LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: chymotrypsin like
• Database Link:
  NP_001898
  Entrez Gene 1506 Human
  UniProt ID P40313
• Background: CTRL contains 1 F-box domain. It is substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.The protein directly interacts with SKP1A and CUL1. A chromosomal aberration involving FBXO25 is a cause of X-linked mental retardation (XLMR).
• Synonyms: CTRL1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 92%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome, Protease