Chymotrypsin like protease (CTRL) Rabbit Polyclonal Antibody

CAT#: TA334672

Rabbit Polyclonal Anti-CTRL Antibody

Product Images

WB Suggested Anti-CTRL Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTRL antibody: synthetic peptide directed towards the N terminal of human CTRL. Synthetic peptide located within the following region: SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: chymotrypsin like
• Database Link:
  NP_001898
  Entrez Gene 1506 Human
  UniProt ID P40313
• Background: The function remains unknown.
• Synonyms: CTRL1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 85%; Mouse: 83%; Pig: 77%

Reference Data

• Protein Families: Druggable Genome, Protease