PHYHIP Rabbit Polyclonal Antibody

CAT#: TA334677

Rabbit Polyclonal Anti-PHYHIP Antibody

Product Images

WB Suggested Anti-PHYHIP Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHYHIP antibody: synthetic peptide directed towards the N terminal of human PHYHIP. Synthetic peptide located within the following region: KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: phytanoyl-CoA 2-hydroxylase interacting protein
• Database Link:
  NP_055574
  Entrez Gene 9796 Human
  UniProt ID Q92561
• Background: PHYHIP interacts with PHYH suggests a role in the development of the central system.
• Synonyms: DYRK1AP3; PAHX-AP; PAHXAP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%