Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody

CAT#: TA334682

Rabbit Polyclonal Anti-PTHLH Antibody

Product Images

Primary antibody dilution: 1:1000; Secondary antibody: Goat anti-rabbit HRP; Secondary antibody dilution:1:2000

• 

  WB Suggested Anti-PTHLH Antibody Titration: 2.0 ug/ml; Positive Control: HepG2 cell lysate

• 

  IHC Information:Rabbit Anti-PTHLH Antibody; Paraffin Embedded Tissue: Human Lung; Cellular Data: Alveolar cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-PTHLH Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of collecting tubule and renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: parathyroid hormone-like hormone
• Database Link:
  NP_002811
  Entrez Gene 5744 Human
  UniProt ID P12272
• Background: PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.
• Synonyms: BDE2; HHM; PLP; PTHR; PTHRP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Mouse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein