Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody

CAT#: TA334683

Rabbit Polyclonal Anti-Pthlh Antibody

Product Images

WB Suggested Anti-Pthlh Antibody Titration: 1 ug/ml; Positive Control: Mouse Brain lysate

• 

  Immunohistochemistry with Lung tissue at an antibody concentration of 5 ug/ml using anti-Pthlh antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pthlh antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: parathyroid hormone-like hormone
• Database Link:
  NP_002811
  Entrez Gene 19227 MouseEntrez Gene 5744 Human
  UniProt ID P12272
• Background: Pthlh is a neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. It regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is required for skeletal homeostasis. It promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. It upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath.
• Synonyms: BDE2; HHM; PLP; PTHR; PTHRP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein