KIF15 Rabbit Polyclonal Antibody

CAT#: TA334701

Rabbit Polyclonal Anti-KIF15 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "KIF15"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KIF15 antibody: synthetic peptide directed towards the middle region of human KIF15. Synthetic peptide located within the following region: SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 160 kDa
Gene Name kinesin family member 15
Background KIF15 is the plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly.
Synonyms HKLP2; KNSL7; NY-BR-62
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Yeast: 83%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.