PARP12 Rabbit Polyclonal Antibody

CAT#: TA334714

Rabbit Polyclonal Anti-PARP12 Antibody

Product Images

WB Suggested Anti-PARP12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: ACHN cell lysatePARP12 is supported by BioGPS gene expression data to be expressed in ACHN

• 

  Rabbit Anti-PARP12 Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARP12 antibody: synthetic peptide directed towards the middle region of human PARP12. Synthetic peptide located within the following region: FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: poly(ADP-ribose) polymerase family member 12
• Database Link:
  NP_073587
  Entrez Gene 64761 Human
  UniProt ID Q9H0J9
• Background: The specific function of this protein remains unknown.
• Synonyms: ARTD12; MST109; MSTP109; ZC3H1; ZC3HDC1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Horse: 93%; Rat: 86%; Mouse: 86%; Bovine: 85%; Rabbit: 83%; Dog: 79%