RGS14 Rabbit Polyclonal Antibody

CAT#: TA334729

Rabbit Polyclonal Anti-Rgs14 Antibody

Product Images

Host: Rabbit; Target Name: Rgs14; Sample Tissue: Mouse Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rgs14 antibody is: synthetic peptide directed towards the middle region of Mouse Rgs14. Synthetic peptide located within the following region: LGSPDTARKKPKLKPGKSLPLGVEELGQLPLAEGPCGRPLRKSFRREMTG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: regulator of G-protein signaling 14
• Database Link:
  NP_006471
  Entrez Gene 51791 Mouse
  UniProt ID O43566
• Background: Rgs14 acts as a regulator of G protein signaling (RGS). It modulates G protein alpha subunits nucleotide exchange and hydrolysis activities by functioning either as a GTPase-activating protein (GAP), thereby driving G protein alpha subunits into their inactive GDP-bound form, or as a GDP-dissociation inhibitor (GDI).
• Synonyms: regulator of G-protein signaling 14; regulator of G-protein signalling 14
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%; Bovine: 92%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome