UBE2N Rabbit Polyclonal Antibody

CAT#: TA334746

Rabbit Polyclonal Anti-UBE2N Antibody

Product Images

Lanes: 1: 40ng HIS-UBE2D1 protein; 2: 40ng HIS-UBE2D2 protein; 3: 40ng HIS-UBE2D3 protein; 4: 40ng HIS-UBE2D4 protein; 5: 40ng HIS-UBE2E1 protein; 6: 40ng HIS-UBE2E2 protein; 7: 40ng HIS-UBE2E3 protein; 8: 40ng HIS-UBE2K protein; 9: 40ng HIS-UBE2L3 protei

• 

  WB Suggested Anti-UBE2N Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysateUBE2N is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Sample Type. Human brain stem cellsPrimary Antibody Dilution. 1:500Secondary Antibody. Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution. 1:1000Color/Signal Descriptions. UBE2N: Red DAPI:BlueGene Name. UBE2NSubmitted by. Dr. Yuzhi Chen, U

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UBE2N antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: ubiquitin conjugating enzyme E2 N
• Database Link:
  NP_003339
  Entrez Gene 93765 MouseEntrez Gene 7334 Human
  UniProt ID P61088
• Background: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
• Synonyms: HEL-S-71; UBC13; UbcH-ben; UbcH13; UBCHBEN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis