CUX1 Rabbit Polyclonal Antibody

CAT#: TA334764

Rabbit Polyclonal Anti-CUX1 Antibody

Product Images

WB Suggested Anti-CUX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CUX1 antibody: synthetic peptide directed towards the N terminal of human CUX1. Synthetic peptide located within the following region: VKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: cut like homeobox 1
• Database Link:
  NP_001904
  Entrez Gene 13047 MouseEntrez Gene 1523 Human
  UniProt ID Q13948
• Background: The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Feb 2011]
• Synonyms: CASP; CDP; CDP1; Clox; COY1; Cut; CUTL1; CUX; Cux; GOLIM6; Nbla10317; p100; p110; p200
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors, Transmembrane