C8orf42 (TDRP) Rabbit Polyclonal Antibody

CAT#: TA334797

Rabbit Polyclonal Anti-TDRP Antibody

Product Images

Host: Rabbit; Target Name: C8orf42; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C8orf42 antibody is: synthetic peptide directed towards the N-terminal region of Human C8orf42. Synthetic peptide located within the following region: EQHLLERCKSPKSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: testis development related protein
• Database Link:
  NP_778250
  Entrez Gene 157695 Human
  UniProt ID Q86YL5
• Background: The function of this protein remains unknown.
• Synonyms: C8orf42; Inm01; TDRP1; TDRP2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 79%; Mouse: 79%