ANKRD36 Rabbit Polyclonal Antibody

CAT#: TA334878

Rabbit Polyclonal Anti-ANKRD36 Antibody

Product Images

Host: Rabbit; Target Name: ANKRD36; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANKRD36 antibody is: synthetic peptide directed towards the C-terminal region of Human ANKRD36. Synthetic peptide located within the following region: MQSYHCRLNAARCDHDQSHSSKRDQELAFQGTVDKCRHLQENLNSHVLIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: ankyrin repeat domain 36
• Database Link:
  NP_001157787
  Entrez Gene 375248 Human
  UniProt ID A6QL64
• Background: The function of this protein remains unknown.
• Synonyms: UNQ2430
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 77%; Horse: 77%; Bovine: 77%