C1orf31 (COA6) Rabbit Polyclonal Antibody

CAT#: TA334890

Rabbit Polyclonal Anti-COA6 Antibody

Product Images

Host: Rabbit; Target Name: COA6; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COA6 antibody is: synthetic peptide directed towards the C-terminal region of Human COA6. Synthetic peptide located within the following region: LDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: cytochrome c oxidase assembly factor 6
• Database Link:
  NP_001013003
  Entrez Gene 388753 Human
  UniProt ID Q5JTJ3
• Background: The function of this protein remains unknown.
• Synonyms: C1orf31; CEMCOX4
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 86%; Horse: 79%; Rabbit: 79%