Sh3kbp1 Rabbit Polyclonal Antibody

CAT#: TA334954

Rabbit Polyclonal Anti-Sh3kbp1 Antibody

Product Images

WB Suggested Anti-Sh3kbp1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sh3kbp1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Sh3kbp1. Synthetic peptide located within the following region: QSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTISQVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: SH3 domain-containing kinase-binding protein 1
• Database Link:
  NP_445812
  Entrez Gene 84357 Rat
  UniProt ID Q925Q9
• Background: Sh3kbp1 binds apoptosis-linked gene 2 (ALG-2) interacting protein 1; involved in regulation of apoptosis in astrocytes.
• Synonyms: CD2BP3; CIN85; GIG10; HSB-1; MIG18
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Goat: 80%; Horse: 79%