ACADVL Rabbit Polyclonal Antibody

CAT#: TA334969

Rabbit Polyclonal Anti-ACADVL Antibody

Product Images

Lanes: 1: Normal controls Normal enzyme expression; 2: Normal controls Normal enzyme expression; 3: Positive mutants Defective enzyme expression; 4: Positive mutants Defective enzyme expression; 5: Positive mutants Defective enzyme expression; Primary Ant

• 

  WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: ACHN cell lysateACADVL is supported by BioGPS gene expression data to be expressed in ACHN

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACADVL antibody: synthetic peptide directed towards the C terminal of human ACADVL. Synthetic peptide located within the following region: IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: acyl-CoA dehydrogenase, very long chain
• Database Link:
  NP_001029031
  Entrez Gene 37 Human
  UniProt ID P49748
• Background: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.
• Synonyms: ACAD6; LCACD; VLCAD
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Fatty acid metabolism, Metabolic pathways