DCUN1D4 Rabbit Polyclonal Antibody

CAT#: TA334980

Rabbit Polyclonal Anti-DCUN1D4 Antibody

Product Images

Host: Rabbit; Target Name: DCUN1D4; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DCUN1D4 antibody is: synthetic peptide directed towards the N-terminal region of Human DCUN1D4. Synthetic peptide located within the following region: TLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPASGDDLSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: defective in cullin neddylation 1 domain containing 4
• Database Link:
  NP_055930
  Entrez Gene 23142 Human
  UniProt ID Q92564
• Background: DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.
• Synonyms: FLJ42355; KIAA0276
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%