PELI3 Rabbit Polyclonal Antibody

CAT#: TA334992

Rabbit Polyclonal Anti-PELI3 Antibody

Product Images

WB Suggested Anti-PELI3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PELI3 antibody: synthetic peptide directed towards the N terminal of human PELI3. Synthetic peptide located within the following region: VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: pellino E3 ubiquitin protein ligase family member 3
• Database Link:
  NP_001091980
  Entrez Gene 246330 Human
  UniProt ID Q8N2H9
• Background: Toll-like receptors (TLRs) and IL1R (IL1R1) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R.Toll-like receptors (TLRs; see MIM 603030) and IL1R (IL1R1; MIM 147810) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R (Jensen and Whitehead, 2003 [PubMed 12874243]). [supplied by OMIM]
• Synonyms: MGC35521
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 92%; Horse: 85%