Kinesin 5C (KIF5C) Rabbit Polyclonal Antibody

CAT#: TA335081

Rabbit Polyclonal Anti-KIF5C Antibody

Product Images

WB Suggested Anti-KIF5C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF5C antibody: synthetic peptide directed towards the N terminal of human KIF5C. Synthetic peptide located within the following region: TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 109 kDa
• Gene Name: kinesin family member 5C
• Database Link:
  NP_004513
  Entrez Gene 3800 Human
  UniProt ID O60282
• Background: KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.
• Synonyms: CDCBM2; KINN; NKHC; NKHC-2; NKHC2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome