HINT1 Rabbit Polyclonal Antibody

CAT#: TA335094

Rabbit Polyclonal Anti-HINT1 Antibody

Product Images

Host: Rabbit; Target Name: HINT1; Sample Tissue: Human Jurkat; Antibody Dilution: 1.0 ug/ml; HINT1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• 

  WB Suggested Anti-HINT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysateHINT1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HINT1 antibody: synthetic peptide directed towards the N terminal of human HINT1. Synthetic peptide located within the following region: CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: histidine triad nucleotide binding protein 1
• Database Link:
  NP_005331
  Entrez Gene 3094 Human
  UniProt ID P49773
• Background: HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.
• Synonyms: HINT; NMAN; PKCI-1; PRKCNH1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%