NDP Rabbit Polyclonal Antibody

CAT#: TA335136

Rabbit polyclonal Anti-NDP Antibody

Product Images

WB Suggested Anti-NDP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Liver

• 

  Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5 ug/ml using anti-NDP antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NDP antibody: synthetic peptide directed towards the middle region of human NDP. Synthetic peptide located within the following region: DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: NDP, norrin cystine knot growth factor
• Database Link:
  NP_000257
  Entrez Gene 4693 Human
  UniProt ID Q00604
• Background: This gene encodes a secreted protein with a cystein-knot motif that activates the Wnt/beta-catenin pathway. The protein forms disulfide-linked oligomers in the extracellular matrix. Mutations in this gene result in Norrie disease and X-linked exudative vitreoretinopathy. [provided by RefSeq, Feb 2009]
• Synonyms: EVR2; FEVR; ND
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein