CSB (ERCC6) Rabbit Polyclonal Antibody

CAT#: TA335163

Rabbit Polyclonal Anti-ERCC6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ERCC6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ERCC6 antibody is: synthetic peptide directed towards the C-terminal region of Human ERCC6. Synthetic peptide located within the following region: EASALLPTTEHDDLLVEMRNFIAFQAHTDGQASTREILQEFESKLSASQS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 94 kDa
Gene Name ERCC excision repair 6, chromatin remodeling factor
Background The function of this protein remains unknown.
Synonyms ARMD5; CKN2; COFS; COFS1; CSB; RAD26; UVSS1
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Dog: 79%; Mouse: 79%; Rabbit: 79%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Nucleotide excision repair

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.