PDX1 Rabbit Polyclonal Antibody

CAT#: TA335165

Rabbit Polyclonal Anti-PDX1 Antibody

Product Images

WB Suggested Anti-PDX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: PANC1 cell lysatePDX1 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1. Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: pancreatic and duodenal homeobox 1
• Database Link:
  NP_000200
  Entrez Gene 18609 MouseEntrez Gene 3651 Human
  UniProt ID P52945
• Background: The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Jul 2008]
• Synonyms: GSF; IDX-1; IPF1; IUF1; MODY4; PAGEN1; PDX-1; STF-1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 92%

Reference Data

• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young, Type II diabetes mellitus