FOXC1 Rabbit Polyclonal Antibody

CAT#: TA335193

Rabbit Polyclonal Anti-FOXC1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "FOXC1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: QQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name forkhead box C1
Background FOXC1 belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly.
Synonyms ARA; FKHL7; FREAC-3; FREAC3; IGDA; IHG1; IRID1; RIEG3
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.