HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody

CAT#: TA335200

Rabbit Polyclonal Anti-HIF1A Antibody

Product Images

HIF1A antibody - middle region validated by WB using chicken liver

• 

  WB Suggested Anti-HIF1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Small Intestine

• 

  Lanes: Lane 1: 80ug Chicken liver (nuclei); Primary Antibody Dilution: 1: 1000; Secondary Antibody: Goat anti-rabbit IgG; Secondary Antibody Dilution: 1: 2, 000; Gene Name: HIF1A; Submitted by: Silvia Moore, Weill Medical College of Cornell University;

• 

  HIF1A antibody - middle region validated by WB using CoCl2 at 1: 500.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Chicken, Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 93 kDa
• Gene Name: hypoxia inducible factor 1 alpha subunit
• Database Link:
  NP_001521
  Entrez Gene 15251 MouseEntrez Gene 3091 Human
  UniProt ID Q16665
• Background: This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2011]
• Synonyms: bHLHe78; HIF-1-alpha; HIF-1A; HIF-1alpha; HIF1; HIF1-ALPHA; MOP1; PASD8
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: mTOR signaling pathway, Pathways in cancer, Renal cell carcinoma