CDX1 Rabbit Polyclonal Antibody

CAT#: TA335206

Rabbit Polyclonal Anti-CDX1 Antibody

Product Images

WB Suggested Anti-CDX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDX1 antibody: synthetic peptide directed towards the N terminal of human CDX1. Synthetic peptide located within the following region: GPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: caudal type homeobox 1
• Database Link:
  NP_001795
  Entrez Gene 1044 Human
  UniProt ID P47902
• Background: This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.
• Synonyms: MGC116915
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Rabbit: 85%; Dog: 79%; Pig: 79%; Mouse: 79%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors