SRD5A2 Rabbit Polyclonal Antibody

CAT#: TA335224

Rabbit Polyclonal Anti-SRD5A2 Antibody

Product Images

WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

• 

  Lanes: Lane 1: 50ug monkey brain extract; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Goat anti rabbit-HRP; Secondary Antibody Dilution: 1: 10, 000; Gene Name: SRD5A2; Submitted by: Jonathan Bertin, Endoceutics Inc.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Monkey
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: steroid 5 alpha-reductase 2
• Database Link:
  NP_000339
  Entrez Gene 6716 Human
  UniProt ID P31213
• Background: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
• Synonyms: MGC138457
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Rabbit: 86%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Androgen and estrogen metabolism, Prostate cancer