Tyrosinase (TYR) Rabbit Polyclonal Antibody

CAT#: TA335226

Rabbit Polyclonal Anti-TYR Antibody

Product Images

WB Suggested Anti-TYR Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TYR antibody: synthetic peptide directed towards the middle region of human TYR. Synthetic peptide located within the following region: CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: tyrosinase
• Database Link:
  NP_000363
  Entrez Gene 7299 Human
  UniProt ID P14679
• Background: TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.
• Synonyms: ATN; CMM8; OCA1; OCA1A; OCAIA; SHEP3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 93%; Guinea pig: 92%; Bovine: 86%; Zebrafish: 83%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Melanogenesis, Metabolic pathways, Riboflavin metabolism, Tyrosine metabolism