EXT2 Rabbit Polyclonal Antibody

CAT#: TA335230

Rabbit Polyclonal Anti-EXT2 Antibody

Product Images

WB Suggested Anti-EXT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

• 

  Host: Rabbit; Target Name: EXT2; Sample Tissue: Human Hela; Antibody Dilution: 1.0 ug/ml; EXT2 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EXT2 antibody: synthetic peptide directed towards the N terminal of human EXT2. Synthetic peptide located within the following region: NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: exostosin glycosyltransferase 2
• Database Link:
  NP_000392
  Entrez Gene 2132 Human
  UniProt ID Q93063
• Background: EXT2 is one of two glycosyltransferases involved in the chain elongation step of heparan sulfate biosynthesis.This gene encodes one of two glycosyltransferases involved in the chain elongation step of heparan sulfate biosynthesis. Mutations in this gene cause the type II form of multiple exostoses. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
• Synonyms: SOTV
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Bovine: 86%; Guinea pig: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Heparan sulfate biosynthesis, Metabolic pathways