HFE Rabbit Polyclonal Antibody

CAT#: TA335234

Rabbit Polyclonal Anti-HFE Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HFE antibody: synthetic peptide directed towards the N terminal of human HFE. Synthetic peptide located within the following region: MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name hemochromatosis
Background HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.
Synonyms HFE1; HH; HLA-H; MVCD7; TFQTL2
Note Immunogen Sequence Homology: Human: 100%; Horse: 86%; Mouse: 86%; Rat: 79%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.