Presenilin 2 (PSEN2) Rabbit Polyclonal Antibody

CAT#: TA335238

Rabbit Polyclonal Anti-Psen2 Antibody

Product Images

Host: Rabbit; Target name: Psen2; Sample Tissue: Rat Stomach lysates; Antibody Dilution: 1.0ug/mL

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Psen2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Psen2. Synthetic peptide located within the following region: TAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: presenilin 2
• Database Link:
  NP_036618
  Entrez Gene 81751 Rat
  UniProt ID P49810
• Background: This gene mutations in human homolog responsible for chromosome 1-linked familial Alzheimer's disease; expression increased during brain development but decreased in the adult.
• Synonyms: AD3L; AD4; CMD1V; PS2; STM2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane
• Protein Pathways: Alzheimer's disease, Notch signaling pathway