TRP1 (TYRP1) Rabbit Polyclonal Antibody

CAT#: TA335247

Rabbit Polyclonal Anti-TYRP1 Antibody

Product Images

WB Suggested Anti-TYRP1 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the N terminal of human TYRP1. Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: tyrosinase related protein 1
• Database Link:
  NP_000541
  Entrez Gene 22178 MouseEntrez Gene 7306 Human
  UniProt ID P17643
• Background: TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.
• Synonyms: b-PROTEIN; CAS2; CATB; GP75; OCA3; TRP; TRP1; TYRP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Melanogenesis, Metabolic pathways, Tyrosine metabolism