TRP1 (TYRP1) Rabbit Polyclonal Antibody

CAT#: TA335248

Rabbit Polyclonal Anti-Tyrp1 Antibody

Product Images

WB Suggested Anti-Tyrp1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tyrp1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: tyrosinase related protein 1
• Database Link:
  NP_000541
  Entrez Gene 298182 Rat
  UniProt ID P17643
• Background: The function of this protein remains unknown.
• Synonyms: b-PROTEIN; CAS2; CATB; GP75; OCA3; TRP; TRP1; TYRP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Melanogenesis, Metabolic pathways, Tyrosine metabolism