M-CSF (CSF1) Rabbit Polyclonal Antibody

CAT#: TA335256

Rabbit Polyclonal Anti-CSF1 Antibody

Product Images

WB Suggested Anti-CSF1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the N terminal of human CSF1. Synthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: colony stimulating factor 1
• Database Link:
  NP_757349
  Entrez Gene 1435 Human
  UniProt ID P09603
• Background: CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. CSF1 may be involved in development of the placenta. The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene.
• Synonyms: CSF-1; MCSF
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Dog: 85%; Pig: 85%; Rat: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Hematopoietic cell lineage