M-CSF (CSF1) Rabbit Polyclonal Antibody

CAT#: TA335257

Rabbit Polyclonal Anti-CSF1 Antibody

Product Images

WB Suggested Anti-CSF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysate

• 

  Human Placenta

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: IF, WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: colony stimulating factor 1
• Database Link:
  NP_000748
  Entrez Gene 1435 Human
  UniProt ID P09603
• Background: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
• Synonyms: CSF-1; MCSF
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 92%; Rat: 86%; Bovine: 83%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Hematopoietic cell lineage