PDE3B Rabbit Polyclonal Antibody

CAT#: TA335263

Rabbit Polyclonal Anti-PDE3B Antibody

Product Images

WB Suggested Anti-PDE3B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 124 kDa
• Gene Name: phosphodiesterase 3B
• Database Link:
  NP_000913
  Entrez Gene 5140 Human
  UniProt ID Q13370
• Background: PDE3B belongs to the cyclic nucleotide phosphodiesterase family. It may play a role in fat metabolism.
• Synonyms: cGIPDE1; HcGIP1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Insulin signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism