FGFR1 Oncogene Partner (FGFR1OP) Rabbit Polyclonal Antibody

CAT#: TA335345

Rabbit Polyclonal Anti-FGFR1OP Antibody

Product Images

WB Suggested Anti-FGFR1OP Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FGFR1OP Antibody: synthetic peptide directed towards the middle region of human FGFR1OP. Synthetic peptide located within the following region: LSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEAN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: FGFR1 oncogene partner
• Database Link:
  NP_919410
  Entrez Gene 11116 Human
  UniProt ID O95684
• Background: FGFR1OP is a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t (6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage.This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage. Alternatively spliced transcript variants that encode different proteins have been identified.
• Synonyms: FOP
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 85%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome