ENPP7 Rabbit Polyclonal Antibody
Other products for "ENPP7"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the middle region of Human ENPP7. Synthetic peptide located within the following region: DLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 49 kDa |
Gene Name | ectonucleotide pyrophosphatase/phosphodiesterase 7 |
Database Link | |
Background | ENPP7 converts sphingomyelin to ceramide. It also has phospholipase C activity toward palmitoyl lyso-phosphocholine and does not appear to have nucleotide pyrophosphatase activity. |
Synonyms | 339221; ALK-SMase; E-NPP 7; NPP-7; NPP7 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 86%; Zebrafish: 86%; Pig: 79%; Horse: 79%; Rabbit: 79% |
Reference Data | |
Protein Pathways | Metabolic pathways, Sphingolipid metabolism |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.