ENPP7 Rabbit Polyclonal Antibody

CAT#: TA335354

Rabbit Polyclonal Anti-ENPP7 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ENPP7"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the middle region of Human ENPP7. Synthetic peptide located within the following region: DLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 49 kDa
Gene Name ectonucleotide pyrophosphatase/phosphodiesterase 7
Background ENPP7 converts sphingomyelin to ceramide. It also has phospholipase C activity toward palmitoyl lyso-phosphocholine and does not appear to have nucleotide pyrophosphatase activity.
Synonyms 339221; ALK-SMase; E-NPP 7; NPP-7; NPP7
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 86%; Zebrafish: 86%; Pig: 79%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Pathways Metabolic pathways, Sphingolipid metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.