GK2 Rabbit Polyclonal Antibody

CAT#: TA335424

Rabbit Polyclonal Anti-GK2 Antibody

Product Images

WB Suggested Anti-GK2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GK2 Antibody: synthetic peptide directed towards the C terminal of human GK2. Synthetic peptide located within the following region: QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: glycerol kinase 2
• Database Link:
  NP_149991
  Entrez Gene 2712 Human
  UniProt ID Q14410
• Background: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.
• Synonyms: GKP2; GKTA
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 85%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways, PPAR signaling pathway