Asrgl1 Rabbit Polyclonal Antibody

CAT#: TA335448

Rabbit Polyclonal Anti-Asrgl1 Antibody

Product Images

WB Suggested Anti-Asrgl1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Asrgl1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: asparaginase like 1
• Database Link:
  NP_079886
  Entrez Gene 66514 Mouse
  UniProt ID Q8C0M9
• Background: Asrgl1 acts in asparagine catabolism. Asrgl1 may be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions.
• Synonyms: ALP; ALP1; CRASH; FLJ22316
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Rabbit: 86%; Horse: 85%; Pig: 80%; Guinea pig: 80%; Rat: 79%; Zebrafish: 79%