TAF7L Rabbit Polyclonal Antibody

CAT#: TA335457

Rabbit Polyclonal Anti-TAF7L Antibody

Product Images

WB Suggested Anti-TAF7L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TAF7L Antibody: synthetic peptide directed towards the middle region of human TAF7L. Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: TATA-box binding protein associated factor 7 like
• Database Link:
  NP_079161
  Entrez Gene 54457 Human
  UniProt ID Q5H9L4
• Background: TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.
• Synonyms: CT40; TAF2Q
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Rat: 91%; Mouse: 91%; Bovine: 79%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors